PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004489944.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB_related
Protein Properties Length: 255aa    MW: 28337.6 Da    PI: 10.5595
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004489944.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-1591135347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++lG+g+W+ I+r + k+Rt+ q+ s+ qky
   XP_004489944.1  91 AWTEEEHKLFLLGLQKLGKGDWRGISRNFVKTRTPTQIASHAQKY 135
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.6E-4523IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.614720IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129415.95583140IPR017930Myb domain
SuperFamilySSF466897.48E-1786139IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1787138IPR006447Myb domain, plants
SMARTSM007173.5E-1088138IPR001005SANT/Myb domain
CDDcd001676.20E-1091136No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1191135IPR009057Homeodomain-like
PfamPF002493.4E-1291135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSQSRTCSQC GNNGHNSRTC NNKEKIIKIF GVPVIRANND NNSFRRSASL NNLTQYEQLP  60
PQQSNVVDVG YISDNVVHAS GRAPERKRAV AWTEEEHKLF LLGLQKLGKG DWRGISRNFV  120
KTRTPTQIAS HAQKYFLRRH NQNRRRRRSS LFDITTDTVM KSLTITEGEH SEQETVMSPP  180
PPTPNAYTPS HYGGIPRITP TLPPSSKMST LNLNEKASSS IEPQPLSLKL QPSSLSKDNS  240
PENSGHSISS SSSSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489944.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B03e-41MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLG7K6Z92e-96G7K6Z9_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA01G04530.15e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.21e-54MYB_related family protein